missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Methionine Sulfoxide Reductase A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Methionine Sulfoxide Reductase A |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
Methionine Sulfoxide Reductase A Polyclonal specifically detects Methionine Sulfoxide Reductase A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Methionine Sulfoxide Reductase A | |
| Unconjugated | |
| RUO | |
| cytosolic methionine-S-sulfoxide reductase, EC 1.8.4.11, methionine sulfoxide reductase A, peptide met (O) reductase, Peptide Met(O) reductase, peptide methionine sulfoxide reductase, Peptide-methionine (S)-S-oxide reductase, PMSR, Protein-methionine-S-oxide reductase | |
| MSRA | |
| IgG |
| Polyclonal | |
| Rabbit | |
| Q9UJ68 | |
| 4482 | |
| Synthetic peptides corresponding to MSRA (methionine sulfoxide reductase A) The peptide sequence was selected from the middle region of MSRA)(50ug). Peptide sequence YQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title