missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MESDC2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£327.00 - £587.00
Specifications
| Antigen | MESDC2 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18622978
|
Novus Biologicals
NBP3-05518-100ul |
100 μg |
£587.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18613319
|
Novus Biologicals
NBP3-05518-25ul |
25 μg |
£327.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MESDC2 Polyclonal antibody specifically detects MESDC2 in Human samples. It is validated for Western BlotSpecifications
| MESDC2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS, pH 7.2, containing 40% glycerol | |
| 23184 | |
| IgG | |
| Affinity purified |
| Western Blot 0.04-0.4 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| BOCA, KIAA0081Renal carcinoma antigen NY-REN-61, MESDLDLR chaperone MESD, mesoderm development candidate 2Mesoderm development protein | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPT | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title