missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MESDC2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-05518-25ul
This item is not returnable.
View return policy
Description
MESDC2 Polyclonal antibody specifically detects MESDC2 in Human samples. It is validated for Western Blot
Specifications
| MESDC2 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL | |
| BOCA, KIAA0081Renal carcinoma antigen NY-REN-61, MESDLDLR chaperone MESD, mesoderm development candidate 2Mesoderm development protein | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPT | |
| 25 μg | |
| Signal Transduction | |
| 23184 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction