missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Melanoma antigen family E1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | Melanoma antigen family E1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Melanoma antigen family E1 Polyclonal specifically detects Melanoma antigen family E1 in Mouse samples. It is validated for Western Blot.Specifications
| Melanoma antigen family E1 | |
| Polyclonal | |
| Rabbit | |
| NP_444431 | |
| 57692 | |
| Synthetic peptide directed towards the C terminal of human Magee1. Peptide sequence GRECTKVFPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEDTEE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Alpha-dystrobrevin-associated MAGE Protein, DAMAGEMAGE-E1 antigen, HCA1, hepatocellular carcinoma-associated HCA1, Hepatocellular carcinoma-associated protein 1, KIAA1587dystrobrevin-associated MAGE protein, melanoma antigen family E, 1, melanoma-associated antigen E1 | |
| MAGEE1 | |
| IgG | |
| 80 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title