missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Melanoma antigen family E1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-91489
This item is not returnable.
View return policy
Description
Melanoma antigen family E1 Polyclonal specifically detects Melanoma antigen family E1 in Mouse samples. It is validated for Western Blot.
Specifications
| Melanoma antigen family E1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Alpha-dystrobrevin-associated MAGE Protein, DAMAGEMAGE-E1 antigen, HCA1, hepatocellular carcinoma-associated HCA1, Hepatocellular carcinoma-associated protein 1, KIAA1587dystrobrevin-associated MAGE protein, melanoma antigen family E, 1, melanoma-associated antigen E1 | |
| Rabbit | |
| 80 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Guinea pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%. | |
| Human, Mouse, Rat, Guinea Pig | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_444431 | |
| MAGEE1 | |
| Synthetic peptide directed towards the C terminal of human Magee1. Peptide sequence GRECTKVFPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEDTEE. | |
| Affinity purified | |
| RUO | |
| 57692 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction