missing translation for 'onlineSavingsMsg'
Learn More
Learn More
mediator of cell motility 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | mediator of cell motility 1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
mediator of cell motility 1 Polyclonal specifically detects mediator of cell motility 1 in Human samples. It is validated for Western Blot.Specifications
| mediator of cell motility 1 | |
| Polyclonal | |
| Rabbit | |
| Q9Y316 | |
| 51072 | |
| Synthetic peptides corresponding to MEMO1(mediator of cell motility 1) The peptide sequence was selected from the middle region of MEMO1. Peptide sequence AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCH. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C21orf19-like protein, C2orf4DKFZp434I0135, CGI-27, FLJ25031, HCV NS5A-transactivated protein 7, Hepatitis C virus NS5A-transactivated protein 7, mediator of cell motility 1, Mediator of ErbB2-driven cell motility 1, memo-1, MEMOchromosome 2 open reading frame 4, NS5ATP7, protein MEMO1 | |
| MEMO1 | |
| IgG | |
| 34 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title