missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MED30 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | MED30 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18205402
|
Novus Biologicals
NBP2-58363 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18663448
|
Novus Biologicals
NBP2-58363-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MED30 Polyclonal specifically detects MED30 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| MED30 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| mediator complex subunit 30TRAP/Mediator complex component TRAP25, mediator of RNA polymerase II transcription subunit 30, putative mediator of RNA polymerase II transcription subunit 30, THRAP6MGC9890, thyroid hormone receptor associated protein 6, Thyroid hormone receptor-associated protein 6, Thyroid hormone receptor-associated protein complex 25 kDa component, Trap25, TRAP25MED30S | |
| MED30 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 90390 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTY | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title