missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MED30 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58363
This item is not returnable.
View return policy
Description
MED30 Polyclonal specifically detects MED30 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| MED30 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| mediator complex subunit 30TRAP/Mediator complex component TRAP25, mediator of RNA polymerase II transcription subunit 30, putative mediator of RNA polymerase II transcription subunit 30, THRAP6MGC9890, thyroid hormone receptor associated protein 6, Thyroid hormone receptor-associated protein 6, Thyroid hormone receptor-associated protein complex 25 kDa component, Trap25, TRAP25MED30S | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| MED30 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTY | |
| 100 μL | |
| Signal Transduction | |
| 90390 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction