MDMX Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18429831	Novus Biologicals NBP1-87733-25ul	25 μL
18263696	Novus Biologicals NBP1-87733	0.1 mL

Description

MDMX Polyclonal specifically detects MDMX in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MDMX
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: DKFZp781B1423, double minute 4 homolog, Double minute 4 protein, double minute 4, human homolog of; p53-binding protein, HDMX, Mdm2-like p53-binding protein, Mdm4 p53 binding protein homolog (mouse), Mdm4, transformed 3T3 cell double minute 4, p53 binding protein, Mdm4, transformed 3T3 cell double minute 4, p53 binding protein (mouse), MDM4-related protein 1, MDMXMGC132766, mouse double minute 4, human homolog of; p53-binding protein, MRP1, p53-binding protein Mdm4, protein Mdm4, Protein Mdmx
• Gene Symbols: MDM4
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Apoptosis, DNA Repair, Signal Transduction
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 4194
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SFSVKDPSPLYDMLRKNLVTLATATTDAAQTLALAQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLP
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only