missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MDMX Antibody, Novus Biologicals™

MDMX Antibody, Novus Biologicals™

Product Code. 18429831 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18429831 25 μL 25µL
18263696 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18429831 Supplier Novus Biologicals Supplier No. NBP18773325ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

MDMX Polyclonal specifically detects MDMX in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MDMX
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias DKFZp781B1423, double minute 4 homolog, Double minute 4 protein, double minute 4, human homolog of; p53-binding protein, HDMX, Mdm2-like p53-binding protein, Mdm4 p53 binding protein homolog (mouse), Mdm4, transformed 3T3 cell double minute 4, p53 binding protein, Mdm4, transformed 3T3 cell double minute 4, p53 binding protein (mouse), MDM4-related protein 1, MDMXMGC132766, mouse double minute 4, human homolog of; p53-binding protein, MRP1, p53-binding protein Mdm4, protein Mdm4, Protein Mdmx
Gene Symbols MDM4
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SFSVKDPSPLYDMLRKNLVTLATATTDAAQTLALAQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLP
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Apoptosis, DNA Repair, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 4194
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.