missing translation for 'onlineSavingsMsg'
Learn More

MCM6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

£297.00 - £402.00

Specifications

Antigen	MCM6
Dilution	Western Blot 0.4 ug/ml, Immunohistochemistry 1:200-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18404941 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP1-82642-25ul	25 μL	£297.00 25µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18238595 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP1-82642	0.1 mL	£402.00 0.10mL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

MCM6 Polyclonal specifically detects MCM6 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen	MCM6
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human, Mouse, Rat
Gene Alias	DNA replication licensing factor MCM6, EC 3.6.4.12, MCG40308, MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe), MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe) (S.cerevisiae), minichromosome maintenance complex component 6, minichromosome maintenance deficient (mis5, S. pombe) 6, minichromosome maintenance deficient 6 homolog, minichromosome maintenance deficient 6 homolog (S. cerevisiae), Mis5, MIS5 homolog, p105MCM
Gene Symbols	MCM6
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of human MCM6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Dilution	Western Blot 0.4 ug/ml, Immunohistochemistry 1:200-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cell Cycle and Replication, DNA Repair
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	4175
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:VILRAEAVESAQAGDKCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLACCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGV
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

MCM6 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents