missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MBP Antibody (7D2), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 2 publications
£163.00 - £389.00
Specifications
| Antigen | MBP |
|---|---|
| Clone | 7D2 |
| Concentration | 1 mg/ml |
| Dilution | Western Blot 1:5000-1:10000, Immunohistochemistry 1:1000, Immunocytochemistry/Immunofluorescence 1:1000 |
| Applications | Western Blot, Immunofluorescence, Immunocytochemistry, Immunohistochemistry |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18224124
|
Novus Biologicals
NBP1-05204-0.025ML |
0.025 mL |
£163.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18738553
|
Novus Biologicals
NBP1-05204 |
0.1 mL |
£389.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MBP Monoclonal specifically detects MBP in Human, Mouse, Rat, Porcine, Bovine, Equine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.Specifications
| MBP | |
| 1 mg/ml | |
| Western Blot, Immunofluorescence, Immunocytochemistry, Immunohistochemistry | |
| Unconjugated | |
| Mouse | |
| Neuroscience, Neurotransmission, Oligodendrocyte Cell Markers, Stem Cell Markers | |
| MGC99675, Myelin A1 protein, myelin basic protein, Myelin membrane encephalitogenic protein | |
| MBP | |
| IgG1 | |
| Affinity purified | |
| The MBP Antibody (7D2) antibody binds only the 21.5kDa and 18.5kDa rat MBP isotypes, but all four isotypes of human and bovine MBP. |
| 7D2 | |
| Western Blot 1:5000-1:10000, Immunohistochemistry 1:1000, Immunocytochemistry/Immunofluorescence 1:1000 | |
| Monoclonal | |
| Ascites | |
| RUO | |
| Rat, Human, Mouse, Equine, Pig, Bovine | |
| 4155 | |
| Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence. | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| 18.5/21.5 kDa |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title