missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LYSMD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | LYSMD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LYSMD1 Polyclonal specifically detects LYSMD1 in Human samples. It is validated for Western Blot.Specifications
| LYSMD1 | |
| Polyclonal | |
| Rabbit | |
| Q96S90 | |
| 388695 | |
| Synthetic peptides corresponding to LYSMD1(LysM, putative peptidoglycan-binding, domain containing 1) The peptide sequence was selected from the N terminal of LYSMD1. Peptide sequence VRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDSIFLKKTLYI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| lysM and putative peptidoglycan-binding domain-containing protein 1, LysM, putative peptidoglycan-binding, domain containing 1, MGC35223, RP11-68I18.5, SB145 | |
| LYSMD1 | |
| IgG | |
| 25 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title