LYSMD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-55447

Product Code. 18286812

Description

LYSMD1 Polyclonal specifically detects LYSMD1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: LYSMD1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: lysM and putative peptidoglycan-binding domain-containing protein 1, LysM, putative peptidoglycan-binding, domain containing 1, MGC35223, RP11-68I18.5, SB145
• Host Species: Rabbit
• Molecular Weight of Antigen: 25 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Guinea Pig 86%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96S90
• Gene Symbols: LYSMD1
• Immunogen: Synthetic peptides corresponding to LYSMD1(LysM, putative peptidoglycan-binding, domain containing 1) The peptide sequence was selected from the N terminal of LYSMD1. Peptide sequence VRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDSIFLKKTLYI.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 388695
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.