missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Lysine-rich coiled-coil 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Lysine-rich coiled-coil 1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Lysine-rich coiled-coil 1 Polyclonal specifically detects Lysine-rich coiled-coil 1 in Human samples. It is validated for Western Blot.Specifications
| Lysine-rich coiled-coil 1 | |
| Polyclonal | |
| Rabbit | |
| NP_057702 | |
| 51315 | |
| Synthetic peptide directed towards the N terminal of human KRCC1. Peptide sequence KMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CHBP2, cryptogenic hepatitis binding protein, Cryptogenic hepatitis-binding protein 2, FLJ22333, lysine-rich coiled-coil 1, lysine-rich coiled-coil protein 1 | |
| KRCC1 | |
| IgG | |
| 31 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title