Lysine-rich coiled-coil 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79654

Product Code. 18260116

Description

Lysine-rich coiled-coil 1 Polyclonal specifically detects Lysine-rich coiled-coil 1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Lysine-rich coiled-coil 1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CHBP2, cryptogenic hepatitis binding protein, Cryptogenic hepatitis-binding protein 2, FLJ22333, lysine-rich coiled-coil 1, lysine-rich coiled-coil protein 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 31 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Equine: 77%.
• Target Species: Human, Equine
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_057702
• Gene Symbols: KRCC1
• Immunogen: Synthetic peptide directed towards the N terminal of human KRCC1. Peptide sequence KMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51315
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.