missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LSM8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£391.00
Specifications
| Antigen | LSM8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LSM8 Polyclonal specifically detects LSM8 in Human samples. It is validated for Western Blot.Specifications
| LSM8 | |
| Polyclonal | |
| Rabbit | |
| O95777 | |
| 51691 | |
| Synthetic peptides corresponding to LSM8 (N(alpha)-acetyltransferase 38, NatC auxiliary subunit) The peptide sequence was selected from the N terminal of LSM8. Peptide sequence MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ33242, LSM8 homolog, U6 small nuclear RNA associated (S. cerevisiae), MAK31-like protein, N(alpha)-acetyltransferase 38, NatC auxiliary subunit, N-alpha-acetyltransferase 38, NatC auxiliary subunit, U6 small nuclear RNA associated, YJR022W | |
| NAA38 | |
| IgG | |
| 10 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title