LSM8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57082

Product Code. 18279224

Description

LSM8 Polyclonal specifically detects LSM8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: LSM8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ33242, LSM8 homolog, U6 small nuclear RNA associated (S. cerevisiae), MAK31-like protein, N(alpha)-acetyltransferase 38, NatC auxiliary subunit, N-alpha-acetyltransferase 38, NatC auxiliary subunit, U6 small nuclear RNA associated, YJR022W
• Host Species: Rabbit
• Molecular Weight of Antigen: 10 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Zebrafish: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O95777
• Gene Symbols: NAA38
• Immunogen: Synthetic peptides corresponding to LSM8 (N(alpha)-acetyltransferase 38, NatC auxiliary subunit) The peptide sequence was selected from the N terminal of LSM8. Peptide sequence MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51691
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.