missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LRRN2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | LRRN2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LRRN2 Polyclonal specifically detects LRRN2 in Human samples. It is validated for Western Blot.Specifications
| LRRN2 | |
| Polyclonal | |
| Rabbit | |
| O75325 | |
| 10446 | |
| Synthetic peptides corresponding to LRRN2(leucine rich repeat neuronal 2) The peptide sequence was selected from the middle region of LRRN2. Peptide sequence RVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FIGLER7, GAC1LRRN5, Glioma amplified on chromosome 1 protein, immunoglobulin and leucine rich repeat domain 7, leucine rich and ankyrin repeats 1, leucine rich repeat neuronal 2, leucine rich repeat neuronal 5, leucine-rich repeat neuronal protein 2, Leucine-rich repeat neuronal protein 5 | |
| LRRN2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title