LRRN2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59796

Product Code. 18269422

Description

LRRN2 Polyclonal specifically detects LRRN2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: LRRN2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FIGLER7, GAC1LRRN5, Glioma amplified on chromosome 1 protein, immunoglobulin and leucine rich repeat domain 7, leucine rich and ankyrin repeats 1, leucine rich repeat neuronal 2, leucine rich repeat neuronal 5, leucine-rich repeat neuronal protein 2, Leucine-rich repeat neuronal protein 5
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10446
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O75325
• Gene Symbols: LRRN2
• Immunogen: Synthetic peptides corresponding to LRRN2(leucine rich repeat neuronal 2) The peptide sequence was selected from the middle region of LRRN2. Peptide sequence RVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine
• Isotype: IgG