missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LRRC73 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | C6orf154 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LRRC73 Polyclonal specifically detects LRRC73 in Human samples. It is validated for Western Blot.Specifications
| C6orf154 | |
| Polyclonal | |
| Rabbit | |
| Q5JTD7 | |
| 221424 | |
| Synthetic peptide directed towards the N terminal of human C6orf154 (NP_001012992). Peptide sequence MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C6orf154, chromosome 6 open reading frame 154, dJ337H4.2, FLJ44836, hypothetical protein LOC221424, leucine rich repeat containing 73, MGC131686 | |
| LRRC73 | |
| IgG | |
| 33 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title