LPAR6/P2RY5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-09507-100UL

Product Code. 18307046

Description

LPAR6/P2RY5 Polyclonal specifically detects LPAR6/P2RY5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: LPAR6/P2RY5
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: G-protein coupled purinergic receptor P2Y5, LAH3, LPA receptor 6, LPA-6, lysophosphatidic acid receptor 6, MGC120358, Oleoyl-L-alpha-lysophosphatidic acid receptor, P2RY5ARWH1, P2Y purinoceptor 5, P2Y5RB intron encoded G-protein coupled receptor, Purinergic receptor 5, purinergic receptor P2Y, G-protein coupled, 5
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human LPAR6/P2RY5 (NP_005758). Peptide sequence GDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAK
• Quantity: 100 μg
• Research Discipline: GPCR
• Gene ID (Entrez): 10161
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified