missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LIPH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | LIPH |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LIPH Polyclonal specifically detects LIPH in Human samples. It is validated for Western Blot.Specifications
| LIPH | |
| Polyclonal | |
| Rabbit | |
| NP_640341 | |
| 200879 | |
| The immunogen for this antibody is LIPH. Peptide sequence LRESCTITAYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYADNWKDHLRG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ARWH2, EC 3.1.1, EC 3.1.1.-, EC 3.1.1.3, LAH2, lipase H, lipase member H, lipase, member H, LPD lipase-related protein, LPDLR, Membrane-associated phosphatidic acid-selective phospholipase A1-alpha, membrane-bound phosphatidic acid-selective phospholipase A1, mPA-PLA1, MPAPLA1, mPA-PLA1 alpha, Phospholipase A1 member B, PLA1BAH | |
| LIPH | |
| IgG | |
| 50 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title