LIPH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79898

Product Code. 18260556

Description

LIPH Polyclonal specifically detects LIPH in Human samples. It is validated for Western Blot.

Specifications

• Antigen: LIPH
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ARWH2, EC 3.1.1, EC 3.1.1.-, EC 3.1.1.3, LAH2, lipase H, lipase member H, lipase, member H, LPD lipase-related protein, LPDLR, Membrane-associated phosphatidic acid-selective phospholipase A1-alpha, membrane-bound phosphatidic acid-selective phospholipase A1, mPA-PLA1, MPAPLA1, mPA-PLA1 alpha, Phospholipase A1 member B, PLA1BAH
• Host Species: Rabbit
• Molecular Weight of Antigen: 50 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Horse: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_640341
• Gene Symbols: LIPH
• Immunogen: The immunogen for this antibody is LIPH. Peptide sequence LRESCTITAYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYADNWKDHLRG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 200879
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.