missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LIPH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79898
This item is not returnable.
View return policy
Description
LIPH Polyclonal specifically detects LIPH in Human samples. It is validated for Western Blot.
Specifications
| LIPH | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| ARWH2, EC 3.1.1, EC 3.1.1.-, EC 3.1.1.3, LAH2, lipase H, lipase member H, lipase, member H, LPD lipase-related protein, LPDLR, Membrane-associated phosphatidic acid-selective phospholipase A1-alpha, membrane-bound phosphatidic acid-selective phospholipase A1, mPA-PLA1, MPAPLA1, mPA-PLA1 alpha, Phospholipase A1 member B, PLA1BAH | |
| Rabbit | |
| 50 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Horse: 86%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_640341 | |
| LIPH | |
| The immunogen for this antibody is LIPH. Peptide sequence LRESCTITAYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYADNWKDHLRG. | |
| Affinity purified | |
| RUO | |
| 200879 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction