missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LIN-28A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-21298-100ul
This item is not returnable.
View return policy
Description
LIN-28A Polyclonal antibody specifically detects LIN-28A in Human samples. It is validated for Immunofluorescence
Specifications
| LIN-28A | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| CSDD1lin-28A, FLJ12457, LIN-28, lin-28 homolog (C. elegans), lin-28 homolog A (C. elegans), Lin-28A, LIN28RNA-binding protein LIN-28, ZCCHC1protein lin-28 homolog A, Zinc finger CCHC domain-containing protein 1, zinc finger, CCHC domain containing 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN | |
| 100 μg | |
| Epigenetics, Neuroscience, Stem Cell Markers, Stem Cells | |
| 79727 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction