missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LDHAL6B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | LDHAL6B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LDHAL6B Polyclonal specifically detects LDHAL6B in Human samples. It is validated for Western Blot.Specifications
| LDHAL6B | |
| Polyclonal | |
| Rabbit | |
| Q9BYZ2 | |
| 92483 | |
| Synthetic peptides corresponding to LDHAL6B(lactate dehydrogenase A-like 6B) The peptide sequence was selected from the middle region of LDHAL6B. Peptide sequence SGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 1.1.1, lactate dehydrogenase A-like 6, lactate dehydrogenase A-like 6B, LDH6B, LDHAL6, LDHLEC 1.1.1.27, L-lactate dehydrogenase A-like 6B | |
| LDHAL6B | |
| IgG | |
| 42 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title