missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LDHAL6B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35488-20ul
This item is not returnable.
View return policy
Description
LDHAL6B Polyclonal antibody specifically detects LDHAL6B in Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| LDHAL6B | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| EC 1.1.1, lactate dehydrogenase A-like 6, lactate dehydrogenase A-like 6B, LDH6B, LDHAL6, LDHLEC 1.1.1.27, L-lactate dehydrogenase A-like 6B | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human LDHAL6B (NP_149972.1).,, Sequence:, MSWTVPVVRASQRVSSVGANFLCLGMALCPRQATRIPLNGTWLFTPVSKMATVKSELIERFTSEKPVHHSKVSIIGTGSV | |
| 20 μL | |
| Primary | |
| Mouse, Rat | |
| Purified |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 92483 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction