missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LDB3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£361.00
Specifications
| Antigen | LDB3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
LDB3 Polyclonal specifically detects LDB3 in Human, Mouse samples. It is validated for Western Blot.Specifications
| LDB3 | |
| Polyclonal | |
| Purified | |
| RUO | |
| CMD1C, CYPHER, KIAA01613, KIAA0613FLJ35865, LDB3Z1, LDB3Z4, LIM domain binding 3, LIM domain-binding protein 3, ORACLE, PDLIM6, PDZ and LIM domain 6, Protein cypher, ZASPLVNC3, Z-band alternatively spliced PDZ-motif protein | |
| LDB3 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| O75112-5 | |
| 11155 | |
| Synthetic peptides corresponding to LDB3(LIM domain binding 3) The peptide sequence was selected from the N terminal of LDB3. Peptide sequence PVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRPTFSPAFSRPS. | |
| Primary | |
| 36 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title