LC3C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57604

Product Code. 18282651

Description

LC3C Polyclonal specifically detects LC3C in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: LC3C
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: ATG8J, Autophagy-related protein LC3 C, Autophagy-related ubiquitin-like modifier LC3 C, LC3C, LC3-like protein 2, MAP1 light chain 3-like protein 2, MAP1 light chain 3-like protein 3, MAP1A/MAP1B LC3 C, microtubule-associated protein 1 light chain 3 gammaMAP1A/MAP1B light chain 3 C, microtubule-associated proteins 1A/1B light chain 3C
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: MAP1LC3C
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TKFLVPQELTMTQFLSIIRSRMVLRATEAF
• Quantity: 100 μL
• Research Discipline: Autophagy, Cellular Markers
• Gene ID (Entrez): 440738
• Target Species: Human
• Isotype: IgG

For Research Use Only