missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LC3C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-57604-25ul
This item is not returnable.
View return policy
Description
LC3C Polyclonal specifically detects LC3C in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| LC3C | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| ATG8J, Autophagy-related protein LC3 C, Autophagy-related ubiquitin-like modifier LC3 C, LC3C, LC3-like protein 2, MAP1 light chain 3-like protein 2, MAP1 light chain 3-like protein 3, MAP1A/MAP1B LC3 C, microtubule-associated protein 1 light chain 3 gammaMAP1A/MAP1B light chain 3 C, microtubule-associated proteins 1A/1B light chain 3C | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| MAP1LC3C | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TKFLVPQELTMTQFLSIIRSRMVLRATEAF | |
| 25 μL | |
| Autophagy, Cellular Markers | |
| 440738 | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction