missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LAP3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | LAP3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LAP3 Polyclonal specifically detects LAP3 in Mouse samples. It is validated for Western Blot.Specifications
| LAP3 | |
| Polyclonal | |
| Rabbit | |
| NP_077754 | |
| 51056 | |
| Synthetic peptide directed towards the N terminal of human Lap3The immunogen for this antibody is Lap3. Peptide sequence QDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKVAVSAKLHGSGD. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 3.4.11, EC 3.4.11.5, LAP, LAPEPEC 3.4.11.1, leucine aminopeptidase 3Prolyl aminopeptidase, Leucyl aminopeptidase, PEPScytosol aminopeptidase, Peptidase SLAP-3, Proline aminopeptidase | |
| LAP3 | |
| IgG | |
| 57 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title