LAP3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79642

Product Code. 18258355

Description

LAP3 Polyclonal specifically detects LAP3 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: LAP3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.4.11, EC 3.4.11.5, LAP, LAPEPEC 3.4.11.1, leucine aminopeptidase 3Prolyl aminopeptidase, Leucyl aminopeptidase, PEPScytosol aminopeptidase, Peptidase SLAP-3, Proline aminopeptidase
• Host Species: Rabbit
• Molecular Weight of Antigen: 57 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Guinea pig: 86%; Zebrafish: 79% Xenopus: 78%; chicken 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_077754
• Gene Symbols: LAP3
• Immunogen: Synthetic peptide directed towards the N terminal of human Lap3The immunogen for this antibody is Lap3. Peptide sequence QDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKVAVSAKLHGSGD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51056
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.