missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LAP (TGF-beta 1) Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£259.00 - £444.00
Specifications
| Antigen | LAP (TGF-beta 1) |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
| Applications | Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18688554
|
Novus Biologicals
NBP3-21360-25ul |
25 μL |
£259.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18646774
|
Novus Biologicals
NBP3-21360-100ul |
100 μL |
£444.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
LAP (TGF-beta 1) Polyclonal antibody specifically detects LAP (TGF-beta 1) in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| LAP (TGF-beta 1) | |
| Immunocytochemistry | |
| Unconjugated | |
| Rabbit | |
| Angiogenesis, Apoptosis, Asthma, Cancer, Immunology, Phospho Specific, Signal Transduction | |
| PBS, pH 7.2, 40% glycerol | |
| 7040 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CED, DPD1, LAP, TGFB, TGFB1, TGFbeta, transforming growth factor beta 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: EWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title