missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LAP (TGF-beta 1) Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-21360-100ul
This item is not returnable.
View return policy
Description
LAP (TGF-beta 1) Polyclonal antibody specifically detects LAP (TGF-beta 1) in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| LAP (TGF-beta 1) | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| CED, DPD1, LAP, TGFB, TGFB1, TGFbeta, transforming growth factor beta 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: EWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHR | |
| 100 μL | |
| Angiogenesis, Apoptosis, Asthma, Cancer, Immunology, Phospho Specific, Signal Transduction | |
| 7040 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunocytochemistry | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction