missing translation for 'onlineSavingsMsg'
Learn More

Laminin alpha 2 Antibody (CL3450), Novus Biologicals™

Mouse Monoclonal Antibody

£294.00 - £452.00

Specifications

Antigen	Laminin alpha 2
Clone	CL3450
Dilution	Western Blot 1 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Monoclonal

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18646475 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-46624-25ul	25 μL	£294.00 25µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18681686 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-46624	0.1 mL	£452.00 0.10mL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

Laminin alpha 2 Monoclonal antibody specifically detects Laminin alpha 2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	Laminin alpha 2
Dilution	Western Blot 1 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500
Classification	Monoclonal
Form	Purified
Regulatory Status	RUO
Formulation	PBS (pH 7.2), 40% Glycerol
Gene Alias	Laminin M chain, laminin subunit alpha-2, laminin, alpha 2, Laminin-12 subunit alpha, Laminin-2 subunit alpha, LAMMLaminin-4 subunit alpha, Merosin heavy chain
Immunogen	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKPEIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIVASRTGRNGT
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Clone	CL3450
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Mouse
Target Species	Human, Mouse, Rat
Gene Accession No.	P24043
Gene ID (Entrez)	3908
Isotype	IgG1
Purification Method	Protein A purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Laminin alpha 2 Antibody (CL3450), Novus Biologicals™

Specifications

Description

Specifications

Documents