L3MBTL4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-39018-25ul

Product Code. 18627295

Description

L3MBTL4 Polyclonal specifically detects L3MBTL4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: L3MBTL4
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q8NA19
• Gene Symbols: L3MBTL4
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IGWCDVTGHPLEVPQRTNDLKILPGQAVCPTPGCRGIGHIRGPRYSGHHSAFGCPYSDMNLKKEATLHDRLREQTQANLESD
• Quantity: 25 μL
• Research Discipline: Apoptosis, Cancer, Tumor Suppressors
• Gene ID (Entrez): 91133
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: FLJ35936, H-l(3)mbt-like protein 4, HsT1031, l(3)mbt-like 4 (Drosophila), L(3)mbt-like protein 4, lethal(3)malignant brain tumor-like protein 4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.