missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Kv3.4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-89887-25ul
This item is not returnable.
View return policy
Description
Kv3.4 Polyclonal antibody specifically detects Kv3.4 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| Kv3.4 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| HKSHIIIC, K+ channel subunit, KSHIIIC, Kv3.4, MGC126818, potassium voltage-gated channel subfamily C member 4, potassium voltage-gated channel, Shaw-related subfamily, member 4, Voltage-gated potassium channel subunit Kv3.4 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: ISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGTRLAWLADPD | |
| 25 μL | |
| Alzheimers Research, Neurodegeneration, Neuroscience | |
| 3749 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunocytochemistry | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction