missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Kv1.1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£260.00 - £587.00
Specifications
| Antigen | Kv1.1 |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18348012
|
Novus Biologicals
NBP3-17729-25UL |
25 μg |
£260.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18372134
|
Novus Biologicals
NBP3-17729-100UL |
100 μg |
£587.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Kv1.1 Polyclonal antibody specifically detects Kv1.1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Kv1.1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Neurodegeneration, Neuroscience | |
| PBS, pH 7.2, 40% glycerol | |
| 3736 | |
| IgG | |
| Affinity purified |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| AEMK, EA1, HBK1, HUK1, Kv1.1, MBK1, MGC126782, MGC138385, MK1, potassium voltage-gated channel subfamily A member 1, potassium voltage-gated channel, shaker-related subfamily, member 1 (episodicataxia with myokymia), RBK1, Voltage-gated K(+) channel HuKI, Voltage-gated potassium channel HBK1, Voltage-gated potassium channel subunit Kv1.1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: QLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title