missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Kv1.1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17729-25UL
This item is not returnable.
View return policy
Description
Kv1.1 Polyclonal antibody specifically detects Kv1.1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Kv1.1 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| AEMK, EA1, HBK1, HUK1, Kv1.1, MBK1, MGC126782, MGC138385, MK1, potassium voltage-gated channel subfamily A member 1, potassium voltage-gated channel, shaker-related subfamily, member 1 (episodicataxia with myokymia), RBK1, Voltage-gated K(+) channel HuKI, Voltage-gated potassium channel HBK1, Voltage-gated potassium channel subunit Kv1.1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: QLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTD | |
| 25 μg | |
| Neurodegeneration, Neuroscience | |
| 3736 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction