missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KLHL9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | KLHL9 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
KLHL9 Polyclonal specifically detects KLHL9 in Human samples. It is validated for Western Blot.Specifications
| KLHL9 | |
| Polyclonal | |
| Rabbit | |
| Q9P2J3 | |
| 55958 | |
| Synthetic peptides corresponding to KLHL9(kelch-like 9 (Drosophila)) The peptide sequence was selected from the middle region of KLHL9. Peptide sequence SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ13568, FLJ21815, kelch-like 9 (Drosophila), kelch-like protein 9, KIAA1354 | |
| KLHL9 | |
| IgG | |
| 69 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title