KLHL9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-55091

Product Code. 18282291

Description

KLHL9 Polyclonal specifically detects KLHL9 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KLHL9
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ13568, FLJ21815, kelch-like 9 (Drosophila), kelch-like protein 9, KIAA1354
• Host Species: Rabbit
• Molecular Weight of Antigen: 69 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected to cross react based on sequence identity: Equine: 86%; Guinea pig: 86%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9P2J3
• Gene Symbols: KLHL9
• Immunogen: Synthetic peptides corresponding to KLHL9(kelch-like 9 (Drosophila)) The peptide sequence was selected from the middle region of KLHL9. Peptide sequence SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55958
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.