missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KLHL14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£387.00
Specifications
| Antigen | KLHL14 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
KLHL14 Polyclonal specifically detects KLHL14 in Human samples. It is validated for Western Blot.Specifications
| KLHL14 | |
| Polyclonal | |
| Purified | |
| RUO | |
| kelch-like 14 (Drosophila), kelch-like protein 14, KIAA1384, printor | |
| KLHL14 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| NP_065856 | |
| 57565 | |
| Synthetic peptide directed towards the N terminal of human KLHL14. Peptide sequence MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAV. | |
| Primary | |
| 71 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title