KLHL14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-80048

Product Code. 18278485

Description

KLHL14 Polyclonal specifically detects KLHL14 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KLHL14
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: kelch-like 14 (Drosophila), kelch-like protein 14, KIAA1384, printor
• Host Species: Rabbit
• Molecular Weight of Antigen: 71 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_065856
• Gene Symbols: KLHL14
• Immunogen: Synthetic peptide directed towards the N terminal of human KLHL14. Peptide sequence MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAV.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57565
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified