KIF21A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-37969-25ul

Product Code. 18613336

Description

KIF21A Polyclonal specifically detects KIF21A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: KIF21A
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: Q7Z4S6
• Gene Symbols: KIF21A
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QKEAQIKVLEGRLKQTEITSATQNQLLFHMLKEKAELNPELDALLGHALQDLDSVPLENVEDSTDEDAPLNS
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CFEOM1, CFEOM3B, FEOM1, FEOM3A, fibrosis of the extraocular muscles, congenital, 1, FLJ20052, KIAA1708DKFZp779C159, KIF2, kinesin family member 21A, Kinesin-like protein KIF2, kinesin-like protein KIF21A, Renal carcinoma antigen NY-REN-62
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55605
• Target Species: Human
• Isotype: IgG