KF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18409471	Novus Biologicals NBP2-31700-25ul	25 μL
18131174	Novus Biologicals NBP2-31700	0.1 mL

Description

KF1 Polyclonal specifically detects KF1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: KF1
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: O00237
• Gene ID (Entrez): 7844
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPVESDWDEDPDLFLERLAFPDLWLHPLIPTDYIKNLPMWRFKCLGVQSE
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Zinc Finger
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: E3 ubiquitin-protein ligase RNF103, EC 6.3.2.-, hkf-1, KF-1, KF1ZFP103ZFP-103, MGC102815, ring finger protein 103MGC41857, Zfp-103, Zinc finger protein 103 homolog, zinc finger protein 103 homolog (mouse), zinc finger protein expressed in cerebellum
• Gene Symbols: RNF103
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only