KCNMB4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10360-100UL

Product Code. 18306785

Description

KCNMB4 Polyclonal specifically detects KCNMB4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KCNMB4
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: BK channel subunit beta-4, BKbeta4, calcium-activated potassium channel subunit beta-4, Calcium-activated potassium channel, subfamily M subunit beta-4, Charybdotoxin receptor subunit beta-4, hbeta4, K(VCA)beta-4, large conductance calcium-dependent potassium ion channel beta 4 subunit, Maxi K channel subunit beta-4, potassium large conductance calcium-activated channel, subfamily M, beta member4, slo-beta-4
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNMB4 (NP_055320). Peptide sequence TCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCK
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27345
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.