KAT4/TBP Associated Factor 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18391295	Novus Biologicals NBP3-10939-100UL	100 μg

Description

KAT4/TBP Associated Factor 1 Polyclonal specifically detects KAT4/TBP Associated Factor 1 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation.

Specifications

• Antigen: KAT4/TBP Associated Factor 1
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: 250kDa, BA2Rdystonia 3 (with Parkinsonism), CCG1TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, 250kD, CCGS, Cell cycle gene 1 protein, cell cycle, G1 phase defect, complementation of cell cycle block, G1-to-S, DYT3/TAF1, EC 2.7.11, EC 2.7.11.1, KAT4, NSCL2, OF, P250, TAF(II)250, TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2AN-TAF1, TAFII-250, TAFII250DYT3, TBP-associated factor 250 kDa, transcription factor TFIID p250 polypeptide, Transcription initiation factor TFIID 250 kDa subunit, transcription initiation factor TFIID subunit 1, XDP
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KAT4/TBP Associated Factor 1 (NP_004597). Peptide sequence MMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEE
• Purification Method: Affinity purified

• Dilution: Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Protein Kinase
• Formulation: PBS buffer, 2% sucrose
• Gene ID (Entrez): 6872
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.