missing translation for 'onlineSavingsMsg'
Learn More

KAT4/TBP Associated Factor 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18391295 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18391295 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18391295 Supplier Novus Biologicals Supplier No. NBP310939100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

KAT4/TBP Associated Factor 1 Polyclonal specifically detects KAT4/TBP Associated Factor 1 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation.
TRUSTED_SUSTAINABILITY

Specifications

Antigen KAT4/TBP Associated Factor 1
Applications ChIP Assay
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation
Formulation PBS buffer, 2% sucrose
Gene Alias 250kDa, BA2Rdystonia 3 (with Parkinsonism), CCG1TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, 250kD, CCGS, Cell cycle gene 1 protein, cell cycle, G1 phase defect, complementation of cell cycle block, G1-to-S, DYT3/TAF1, EC 2.7.11, EC 2.7.11.1, KAT4, NSCL2, OF, P250, TAF(II)250, TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2AN-TAF1, TAFII-250, TAFII250DYT3, TBP-associated factor 250 kDa, transcription factor TFIID p250 polypeptide, Transcription initiation factor TFIID 250 kDa subunit, transcription initiation factor TFIID subunit 1, XDP
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KAT4/TBP Associated Factor 1 (NP_004597). Peptide sequence MMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEE
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 6872
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.