missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KAP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | KAP1 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18646405
|
Novus Biologicals
NBP2-39014-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18165928
|
Novus Biologicals
NBP2-39014 |
0.1 mL |
£488.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
KAP1 Polyclonal specifically detects KAP1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| KAP1 | |
| Polyclonal | |
| Rabbit | |
| Chromatin Research, DNA Repair, DNA replication Transcription Translation and Splicing, Protein Kinase, Signal Transduction, Transcription Factors and Regulators, Zinc Finger | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| E3 SUMO-protein ligase TRIM28, EC 6.3.2.-, FLJ29029, KAP-1, KAP1KRAB-associated protein 1, KRIP-1, Nuclear corepressor KAP-1, RNF96KRAB-interacting protein 1, TF1B, TIF1-beta, TIF1BRING finger protein 96, transcription intermediary factor 1-beta, transcriptional intermediary factor 1-beta, tripartite motif containing 28, tripartite motif-containing 28, Tripartite motif-containing protein 28 | |
| TRIM28 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q13263 | |
| 10155 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRFFETRMNEAFGDTKFSAVLV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title