missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KAP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-39014
This item is not returnable.
View return policy
Description
KAP1 Polyclonal specifically detects KAP1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| KAP1 | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Q13263 | |
| TRIM28 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRFFETRMNEAFGDTKFSAVLV | |
| 0.1 mL | |
| Chromatin Research, DNA Repair, DNA replication Transcription Translation and Splicing, Protein Kinase, Signal Transduction, Transcription Factors and Regulators, Zinc Finger | |
| 10155 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| E3 SUMO-protein ligase TRIM28, EC 6.3.2.-, FLJ29029, KAP-1, KAP1KRAB-associated protein 1, KRIP-1, Nuclear corepressor KAP-1, RNF96KRAB-interacting protein 1, TF1B, TIF1-beta, TIF1BRING finger protein 96, transcription intermediary factor 1-beta, transcriptional intermediary factor 1-beta, tripartite motif containing 28, tripartite motif-containing 28, Tripartite motif-containing protein 28 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction